MGF

MGF (Mechano Growth Factor), also known as IGF-1Ec, is a splice variant of the Insulin-Like Growth Factor-1 (IGF-1) gene that is expressed in response to mechanical overload, tissue damage, or cellular stress. This peptide sequence differs from standard IGF-1 by an altered E-domain, giving it distinct biological properties and a localized, short-term role in cellular growth and repair.

In pre-clinical and in-vitro research, MGF has been studied for its ability to activate satellite cells, stimulate muscle regeneration, and enhance tissue repair independent of systemic IGF-1 signaling. It is particularly valuable in models of skeletal muscle hypertrophy, cardiac repair, and cellular adaptation to mechanical stress.

$50.00

$50.00
1 - 2
$39.00 (22% off)
3 - 5
$27.30 (45% off)
6 - 9
$23.40 (53% off)
10+
Category
MGF (Mechano Growth Factor), also known as IGF-1Ec, is a splice variant of the Insulin-Like Growth Factor-1 (IGF-1) gene that is expressed in response to mechanical overload, tissue damage, or cellular stress. This peptide sequence differs from standard IGF-1 by an altered E-domain, giving it distinct biological properties and a localized, short-term role in cellular growth and repair. In pre-clinical and in-vitro research, MGF has been studied for its ability to activate satellite cells, stimulate muscle regeneration, and enhance tissue repair independent of systemic IGF-1 signaling. It is particularly valuable in models of skeletal muscle hypertrophy, cardiac repair, and cellular adaptation to mechanical stress.
Property
Specification
Peptide Name:
MGF (Mechano Growth Factor, IGF-1Ec)
Sequence:
YQPPSTNKNTKSQRRKGSTFEEHKHNPPKSA
Amino Acid Length:
24
Molecular Formula:
C121H200N42O39
Molecular Weight:
~2867.2 Da
CAS Number:
114274-44-9
Peptide Type:
IGF-1 splice variant / E-domain analog
Structure Type:
Linear polypeptide
Form:
Lyophilized white/off-white powder
Purity:
99 % (HPLC verified)
Solubility:
Soluble in sterile water or 0.1 % acetic acid for research reconstitution
Storage:
−20 °C, protected from light and moisture
Stability:
Stable for up to 24 months under recommended storage conditions

Muscle Regeneration and Satellite Cell Activation

  • MGF is a critical component in studies of muscle fiber regeneration and myoblast proliferation.
  • Shown in pre-clinical models to activate satellite cells—the resident stem cells responsible for muscle repair and hypertrophy.
  • Provides a key model for understanding mechanotransduction, the cellular response to physical stress or injury.

Localized Anabolic Signaling

  • Functions primarily in autocrine and paracrine pathways, producing localized anabolic effects distinct from systemic IGF-1 signaling.
  • Used to study tissue-specific growth factor expression and short-acting peptide cascades following mechanical stress.
  • Enables researchers to compare IGF-1Ec (MGF) with IGF-1 LR3 and IGF-1 DES (1–3) for differential growth responses.

Protein Synthesis and Cellular Growth Studies

  • Stimulates mRNA translation, ribosomal biogenesis, and protein synthesis via PI3K/Akt and mTOR pathways.
  • Provides a framework for analyzing peptide-induced anabolic signaling and muscle hypertrophy mechanisms in cell culture and animal models.

Injury Recovery and Tissue Repair Research

  • Studied for its influence on fibroblast proliferation, collagen synthesis, and angiogenesis following tissue injury.
  • Enables investigation into local peptide-mediated healing processes independent of systemic hormones.
  • Often paired with BPC-157 and TB-500 in regenerative peptide research.

Cardiovascular and Ischemic Research

  • MGF has demonstrated potential cardioprotective effects in pre-clinical studies by stimulating cardiac progenitor cell proliferation.
  • Provides a model for myocardial repair and angiogenic recovery following ischemic events.
  • Useful in research on cardiac peptide expression post-stress or injury.

Cellular Aging and Longevity Studies

  • Investigated for its role in cellular turnover and mitochondrial protection within senescent muscle tissue.
  • Offers a model for studying growth factor imbalance during aging and muscle atrophy prevention pathways.

This product is supplied strictly for laboratory research use only. It is not a drug, food, or cosmetic and must not be administered to humans or animals. Proper handling procedures and safety protocols should be followed by trained professionals when working with this material.

BAC WATER

Price range: $6.00 through $9.99

SELANK

$25.00

Melanotan 2

$34.00

PT 141

$34.00

Related Product

Disclaimer: For Research Use Only

All products and information presented on this website are intended solely for laboratory and scientific research purposes. Nothing contained herein should be interpreted as a recommendation, endorsement, or authorization for human consumption, medical use, or diagnostic application.

Any references to specific peptides, studies, or potential biological functions are provided strictly for informational and educational purposes. Such content must not be considered medical, health, or legal advice, nor encouragement for non-research use.

All compounds are designed for controlled research environments and may be handled only by qualified professionals familiar with appropriate laboratory procedures and regulations. Customers and researchers are urged to consult with scientific, medical, or legal experts before ordering or utilizing any materials.

Revacta Labs promotes the ethical, safe, and lawful study of research-grade materials and expects all users to adhere to applicable local and federal guidelines. This disclaimer applies to all website content, communications, and products offered by Revacta Labs and is subject to change without notice.

What are you looking for today?