IGF-1 DES

IGF-1 DES (1–3) is a shortened analog of human Insulin-Like Growth Factor-1 (IGF-1), consisting of 67 amino acids instead of 70. It lacks the first three amino acids (Gly-Pro-Glu) at the N-terminus of native IGF-1, resulting in enhanced receptor binding affinity and reduced interaction with IGF Binding Proteins (IGFBPs).

These structural modifications allow IGF-1 DES to demonstrate superior local potency and shorter systemic half-life, making it ideal for in-vitro and pre-clinical research involving cellular proliferation, regeneration, tissue growth, and protein synthesis signaling.

In experimental settings, IGF-1 DES is widely utilized to explore muscle cell differentiation, wound healing, neuroprotection, and anabolic mechanisms through its influence on the IGF-1 receptor (IGF-1R) and downstream PI3K/Akt and MAPK signaling cascades.

$60.00

$60.00
1 - 2
$48.00 (20% off)
3 - 5
$42.00 (30% off)
6 - 9
$36.00 (40% off)
10+
Category
IGF-1 DES (1–3) is a shortened analog of human Insulin-Like Growth Factor-1 (IGF-1), consisting of 67 amino acids instead of 70. It lacks the first three amino acids (Gly-Pro-Glu) at the N-terminus of native IGF-1, resulting in enhanced receptor binding affinity and reduced interaction with IGF Binding Proteins (IGFBPs). These structural modifications allow IGF-1 DES to demonstrate superior local potency and shorter systemic half-life, making it ideal for in-vitro and pre-clinical research involving cellular proliferation, regeneration, tissue growth, and protein synthesis signaling. In experimental settings, IGF-1 DES is widely utilized to explore muscle cell differentiation, wound healing, neuroprotection, and anabolic mechanisms through its influence on the IGF-1 receptor (IGF-1R) and downstream PI3K/Akt and MAPK signaling cascades.
Property
Specification
Peptide Name:
IGF-1 DES (1–3)
Sequence:
TGPSSDSRRSRRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Amino Acid Length:
67
Molecular Formula:
C₃₁₉H₅₀₈N₉₄O₉₂S₇
Molecular Weight:
~7649.4 Da
CAS Number:
946870-90-2
Peptide Type:
Recombinant human IGF-1 analog (des-tripeptide variant)
Structural Modifications:
N-terminal truncation (removal of Gly-Pro-Glu) to enhance receptor binding and minimize IGFBP interaction
Form:
Lyophilized white or off-white powder
Purity:
99 % (HPLC verified)
Solubility:
Soluble in sterile water or 0.1 % acetic acid for research reconstitution
Storage:
−20 °C, protected from light and moisture
Stability:
Stable for up to 24 months under recommended storage conditions

Cellular Growth and Proliferation Studies

  • Demonstrates higher potency in stimulating cellular proliferation and differentiation than native IGF-1 due to increased IGF-1R activation.
  • Used to examine mitogenic and anabolic signaling pathways in myoblasts, fibroblasts, and epithelial cells.
  • Supports research into cell cycle regulation, growth factor signaling, and tissue regeneration dynamics.

Muscle Growth and Regeneration Models

  • Enables study of muscle hypertrophy, protein synthesis, and tissue repair via PI3K/Akt/mTOR pathway activation.
  • Commonly employed alongside GH secretagogues (e.g., CJC-1295 or GHRP-6) to investigate synergistic anabolic signaling.
  • Provides a framework for exploring muscle satellite cell activation and myonuclear proliferation.

Protein Synthesis and Anabolic Pathways

  • Acts as a potent stimulator of protein transcription and translation in various cell types.
  • Used in pre-clinical studies to assess IGF-1–dependent anabolic responses, including ribosomal activation and mTOR signaling modulation.

Wound Healing and Tissue Repair Research

  • IGF-1 DES has been studied for its ability to accelerate fibroblast migration, collagen deposition, and angiogenesis in wound-healing models.
  • Supports examination of growth factor-mediated recovery in skin, tendon, and connective tissue repair systems.

Neuroprotective and Neural Regeneration Research

  • Investigated in neuronal models for promoting neurite outgrowth, synaptic recovery, and oxidative damage resistance.
  • Provides insight into IGF-1R-mediated neurotrophic signaling, axon regeneration, and cell survival mechanisms in neurobiology research.

Localized Anabolic and Regenerative Effects

  • The short half-life and enhanced receptor affinity allow IGF-1 DES to act locally and transiently, mimicking physiological pulsatile growth factor release.
  • Ideal for studying site-specific cellular responses and localized growth factor kinetics without prolonged systemic activity.

This product is supplied strictly for laboratory research use only. It is not a drug, food, or cosmetic and must not be administered to humans or animals. Proper handling procedures and safety protocols should be followed by trained professionals when working with this material.

BAC WATER

Price range: $6.00 through $9.99

SELANK

$25.00

Melanotan 2

$34.00

PT 141

$34.00

Related Product

Disclaimer: For Research Use Only

All products and information presented on this website are intended solely for laboratory and scientific research purposes. Nothing contained herein should be interpreted as a recommendation, endorsement, or authorization for human consumption, medical use, or diagnostic application.

Any references to specific peptides, studies, or potential biological functions are provided strictly for informational and educational purposes. Such content must not be considered medical, health, or legal advice, nor encouragement for non-research use.

All compounds are designed for controlled research environments and may be handled only by qualified professionals familiar with appropriate laboratory procedures and regulations. Customers and researchers are urged to consult with scientific, medical, or legal experts before ordering or utilizing any materials.

Revacta Labs promotes the ethical, safe, and lawful study of research-grade materials and expects all users to adhere to applicable local and federal guidelines. This disclaimer applies to all website content, communications, and products offered by Revacta Labs and is subject to change without notice.

Scroll to Top

What are you looking for today?