IGF-1 LR3

IGF-1 LR3 (Insulin-Like Growth Factor-1 Long Arg3) is a synthetic analog of naturally occurring human IGF-1, engineered to exhibit enhanced stability, increased bioavailability, and prolonged receptor activity. It differs structurally from native IGF-1 by an extended N-terminal peptide chain (13 amino acids) and a substitution of arginine for glutamic acid at position 3—modifications that dramatically reduce its affinity for IGF binding proteins (IGFBPs) while maintaining potent activity at the IGF-1 receptor (IGF-1R).

These features make IGF-1 LR3 a cornerstone compound for research into cell proliferation, differentiation, protein synthesis, recovery mechanisms, and metabolic regulation.
In pre-clinical models, IGF-1 LR3 has been utilized to investigate muscle cell regeneration, neuroprotection, glucose transport, and anabolic signaling pathways.

$59.00

$59.00
1 - 2
$47.20 (20% off)
3 - 5
$41.30 (30% off)
6 - 9
$35.40 (40% off)
10+
Category
IGF-1 LR3 (Insulin-Like Growth Factor-1 Long Arg3) is a synthetic analog of naturally occurring human IGF-1, engineered to exhibit enhanced stability, increased bioavailability, and prolonged receptor activity. It differs structurally from native IGF-1 by an extended N-terminal peptide chain (13 amino acids) and a substitution of arginine for glutamic acid at position 3—modifications that dramatically reduce its affinity for IGF binding proteins (IGFBPs) while maintaining potent activity at the IGF-1 receptor (IGF-1R). These features make IGF-1 LR3 a cornerstone compound for research into cell proliferation, differentiation, protein synthesis, recovery mechanisms, and metabolic regulation. In pre-clinical models, IGF-1 LR3 has been utilized to investigate muscle cell regeneration, neuroprotection, glucose transport, and anabolic signaling pathways.
Property
Specification
Peptide Name:
IGF-1 LR3 (Insulin-Like Growth Factor-1 Long Arg3)
Sequence:
MFPAMPLLSGLRSR–(IGF-1 core)–RAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Amino Acid Length:
83
Molecular Formula:
C₄₀₆H₆₂₅N₁₁₁O₁₂₀S₉
Molecular Weight:
~9117.5 Da
CAS Number:
946870-92-4
Peptide Type:
Recombinant human IGF-1 analog
Structural Modifications:
Arginine substitution at position 3 (E3R); 13-residue N-terminal extension (Long R3 modification)
Form:
Lyophilized white/off-white powder
Purity:
99 % (HPLC verified)
Solubility:
Soluble in sterile water or 0.1 % acetic acid for research reconstitution
Storage:
−20 °C, protected from light and moisture
Stability:
Stable for 24 months under recommended conditions

Cellular Growth and Differentiation Studies

  • IGF-1 LR3 is widely used to study cell proliferation and differentiation through activation of the PI3K/Akt and MAPK pathways.
  • Enables research into myoblast proliferation, chondrocyte development, and osteoblast differentiation.
  • Supports evaluation of IGF-1R-mediated mitogenic and anabolic signaling.

Protein Synthesis and Muscle Regeneration Research

  • Frequently used to examine protein synthesis up-regulation and skeletal muscle recovery in cell cultures and animal models.
  • Activates mTOR-dependent pathways, providing a model for growth signaling, muscle hypertrophy, and recovery physiology.

Insulin Signaling and Glucose Uptake Mechanisms

  • Shares structural homology with insulin, allowing investigation into glucose transport, insulin sensitivity, and metabolic crosstalk between IGF-1R and insulin receptors.
  • Aids in studying glycogen storage, energy homeostasis, and glucose metabolism in pre-clinical models.

Cellular Repair and Tissue Regeneration

  • Used to explore fibroblast proliferation, angiogenesis, and connective tissue regeneration.
  • Provides insight into wound-healing cascades, growth factor synergy, and ECM remodeling.
  • Commonly studied alongside peptides such as BPC-157, TB-500, and GH secretagogues.

Neuroprotective and Cognitive Research

  • Investigated in neuronal models for its role in neurotrophic support and synaptic repair.
  • Facilitates studies on neural plasticity, axon regeneration, and oxidative stress resistance.

Longevity and Aging Pathway Research

  • IGF-1 LR3’s modulation of cellular growth and stress resistance makes it a critical model compound for studying mTOR, FOXO, and AMPK signaling in aging.
  • Provides data for research into cellular senescence, metabolic resilience, and longevity regulation.

This product is supplied strictly for laboratory research use only. It is not a drug, food, or cosmetic and must not be administered to humans or animals. Proper handling procedures and safety protocols should be followed by trained professionals when working with this material.

BAC WATER

Price range: $6.00 through $9.99

SELANK

$25.00

Melanotan 2

$34.00

PT 141

$34.00

Related Product

Disclaimer: For Research Use Only

All products and information presented on this website are intended solely for laboratory and scientific research purposes. Nothing contained herein should be interpreted as a recommendation, endorsement, or authorization for human consumption, medical use, or diagnostic application.

Any references to specific peptides, studies, or potential biological functions are provided strictly for informational and educational purposes. Such content must not be considered medical, health, or legal advice, nor encouragement for non-research use.

All compounds are designed for controlled research environments and may be handled only by qualified professionals familiar with appropriate laboratory procedures and regulations. Customers and researchers are urged to consult with scientific, medical, or legal experts before ordering or utilizing any materials.

Revacta Labs promotes the ethical, safe, and lawful study of research-grade materials and expects all users to adhere to applicable local and federal guidelines. This disclaimer applies to all website content, communications, and products offered by Revacta Labs and is subject to change without notice.

Scroll to Top

What are you looking for today?